Protein Info for Synpcc7942_B2628 in Synechococcus elongatus PCC 7942

Name: srpKLM
Annotation: sulfonate ABC transporter, ATP-binding protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00005: ABC_tran" amino acids 40 to 182 (143 residues), 122.5 bits, see alignment E=2.9e-39

Best Hits

Swiss-Prot: 47% identical to SSUB2_BURL3: Aliphatic sulfonates import ATP-binding protein SsuB 2 (ssuB2) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 100% identity to syf:Synpcc7942_B2628)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R6V2 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Synpcc7942_B2628 sulfonate ABC transporter, ATP-binding protein, putative (Synechococcus elongatus PCC 7942)
MTTTIADPVVSSRSPTDVILQARSLTKHYRSGNHNVTAFKDLTLSLHPGEIVCLLGPSGC
GKSSLLQAIASLEPIDAGEIQFLGQPLQQPHPRIGFVFQEPALLPWQTVWQNVSFGLELK
QGPQLSEAQRRSRISDALNRVGLAGAERAYPRQLSGGMAQRVALARALARHPHLLLLDEP
FAALDAIHRLEMQKLLLEAIAGQTEAVLMVTHDLDEALLLGDRIILMHRNPGRFGQQWII
PQPRPRFQKLTDLSALRAEILQALSDSLTA