Protein Info for Synpcc7942_2602 in Synechococcus elongatus PCC 7942

Name: ctaC
Annotation: cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details PF02790: COX2_TM" amino acids 22 to 111 (90 residues), 66.3 bits, see alignment E=2.2e-22 PF00116: COX2" amino acids 194 to 260 (67 residues), 50.3 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to syf:Synpcc7942_2602)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31JY7 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Synpcc7942_2602 cytochrome c oxidase subunit II (Synechococcus elongatus PCC 7942)
VAIPSNILTLLAGVAITCLSLWYGQNHGLLPVAAATDAPLVDGLFNTMMTIATGLFLLVQ
GLIFVILWRFRRKPNDVTDAAPIHGNLALEILWTGIPVVIVLGLSVYSFSVYTTMGGLSV
GHGGGHMAHAQPRDSAIAAELSSDSLQDSKSTPRVSAGLGAPTEALPDVTVNVKGLQFAW
IFNYPSHNLIAGELHLPLGKSVQLEIEAQDVIHAFWVPQFRLKQDAIPGERTRLQFTPTQ
LGTYPIVCAELCGSYHGAMRSQVIVETPEDYDRWIQSQTTTAAVVPSRLETATAALDLQV
EPEHLHHLHQLASSL