Protein Info for Synpcc7942_2565 in Synechococcus elongatus PCC 7942

Name: efp
Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00038: translation elongation factor P" amino acids 2 to 184 (183 residues), 260 bits, see alignment E=5.3e-82 PF08207: EFP_N" amino acids 3 to 60 (58 residues), 97.6 bits, see alignment E=5.1e-32 PF01132: EFP" amino acids 69 to 121 (53 residues), 80 bits, see alignment E=1.5e-26 PF09285: Elong-fact-P_C" amino acids 129 to 184 (56 residues), 94.9 bits, see alignment E=2.8e-31

Best Hits

Swiss-Prot: 100% identical to EFP_SYNE7: Elongation factor P (efp) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to syc:syc1545_d)

MetaCyc: 49% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q54760 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Synpcc7942_2565 elongation factor P (Synechococcus elongatus PCC 7942)
MISSNDFRTGTTIEIDGAVWRVVEFLHVKPGKGSAFVRTKLKNAKTGNVVEKTFRAGETV
PQAVLEKSTLQYTYKDGDDFVFMDMETYEEGRLTAATIGDRVKYLKEGMEANVITWNGQV
IEVELPNSVVLEVIETDPGVKGDTATGGTKPAKVETGAQVMVPLFISVGERIKIDTRNDS
YLGRE