Protein Info for Synpcc7942_2552 in Synechococcus elongatus PCC 7942

Name: hypB
Annotation: hydrogenase accessory protein HypB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR00073: hydrogenase accessory protein HypB" amino acids 24 to 233 (210 residues), 274.3 bits, see alignment E=3.1e-86 PF02492: cobW" amino acids 54 to 212 (159 residues), 79 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 53% identical to HYPB_SYNY3: Hydrogenase maturation factor HypB (hypB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 100% identity to syf:Synpcc7942_2552)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31K37 at UniProt or InterPro

Protein Sequence (242 amino acids)

>Synpcc7942_2552 hydrogenase accessory protein HypB (Synechococcus elongatus PCC 7942)
MCGVCGCQSPDPVVIATPEPRQISLAEAILHRNDHAAAHNREHFQRAGVLALNLLSSPGS
GKTALLERTLRELPPTLRPAAIVGDLATDRDAQRLQATGAPAIQIETGELCHLEADLVHR
ACHQLDLSAIDILFIENVGNLVCPAAFDLGEERRVLLLSVTEGEDKPLKYPSAFSRADLV
LITKVDLAEAVEFDQAAAIANLRAVNPTATILPVSSRGGQGWSDWLDWLQVQRSHLLAPV
KA