Protein Info for Synpcc7942_2495 in Synechococcus elongatus PCC 7942

Name: natD
Annotation: integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details amino acids 36 to 37 (2 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 71 to 96 (26 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 213 to 239 (27 residues), see Phobius details amino acids 249 to 275 (27 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 297 (290 residues), 138.7 bits, see alignment E=1e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to syf:Synpcc7942_2495)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q935W9 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Synpcc7942_2495 integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD (Synechococcus elongatus PCC 7942)
MDWLQPLINGLAIGGVYALFALGYTLVFSILGVINFAHGAVFTLGAYLTYALVGGRFSFN
GLLANAALPFSLPFALALLLGSLLAGGASLLIEQVAFRPLRRRQADPLLTLISSLGVAVF
IVNLIQILVGAEIYTFPSNIYGDLPSAINLGSSDRPIQIRTVQIILFVVAIAMFSLLTWL
INGTRVGHALKAVAEDATTASLLGIDPDRYIRLTFFLSGVLGGLAGTLVGTSVSITGPYF
GIAYGLKGLSVMVLGGLGNIPGTIAGGLLLGLAEAWVPPQWSGYRDAVAFALLFAMLLIR
PQGLFSRARTEKV