Protein Info for Synpcc7942_2425 in Synechococcus elongatus PCC 7942

Name: ycf39
Annotation: chaperon-like protein for quinone binding in photosystem II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF05368: NmrA" amino acids 3 to 235 (233 residues), 103.9 bits, see alignment E=2.6e-33 PF01370: Epimerase" amino acids 3 to 109 (107 residues), 60.9 bits, see alignment E=2.5e-20 PF01073: 3Beta_HSD" amino acids 4 to 113 (110 residues), 41.5 bits, see alignment E=1.7e-14 PF13460: NAD_binding_10" amino acids 7 to 193 (187 residues), 103.7 bits, see alignment E=2.3e-33

Best Hits

Swiss-Prot: 50% identical to YCF39_CYAPA: Uncharacterized protein ycf39 (ycf39) from Cyanophora paradoxa

KEGG orthology group: None (inferred from 100% identity to syc:syc1681_d)

Predicted SEED Role

"Putative chaperon-like protein Ycf39 for quinone binding in Photosystem II" in subsystem Chlorophyll Biosynthesis or Photosystem II

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KG4 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Synpcc7942_2425 chaperon-like protein for quinone binding in photosystem II (Synechococcus elongatus PCC 7942)
MDVLVVGATGTLGRQIARRALDEGHRVRCLVRSPKRGNFLREWGCDLVRGDLTQPESLTF
ALEGIEAVIDAATTRSTDSLSCYDVDWQGKVNLIKAATEAGVQRFVFCSIIDAEKHRDVP
LMDIKYCTEEFLRQSGLNYTILRLAGFMQGLIAEFAIPVLEGRTAFITQDSDPIAYLSTL
DIARFAVAALTTPATEKQTLPVVGPKAWSGLEIFRLCERLSGKETKIARLPLATVSAMKR
FFRFFQWGWNIADRLAFSEVMACGRPFTADMAATYTAFGIDPAEITGLESYLNDYFSVML
RRLKELEFDQKKDKKKKVPF