Protein Info for Synpcc7942_2340 in Synechococcus elongatus PCC 7942

Name: engA
Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 436 (433 residues), 554.3 bits, see alignment E=3.3e-170 PF00009: GTP_EFTU" amino acids 4 to 166 (163 residues), 32.1 bits, see alignment E=4.3e-11 amino acids 210 to 350 (141 residues), 45.2 bits, see alignment E=4.3e-15 TIGR00231: small GTP-binding protein domain" amino acids 6 to 126 (121 residues), 66.4 bits, see alignment E=3.8e-22 amino acids 176 to 346 (171 residues), 91.6 bits, see alignment E=6.9e-30 PF02421: FeoB_N" amino acids 6 to 61 (56 residues), 30.1 bits, see alignment 1.6e-10 amino acids 180 to 344 (165 residues), 42.3 bits, see alignment E=2.9e-14 PF01926: MMR_HSR1" amino acids 6 to 121 (116 residues), 95.1 bits, see alignment E=1.6e-30 amino acids 180 to 297 (118 residues), 102.6 bits, see alignment E=6.9e-33 PF14714: KH_dom-like" amino acids 355 to 436 (82 residues), 104.9 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 100% identical to DER_SYNE7: GTPase Der (der) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to syf:Synpcc7942_2340)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KP9 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Synpcc7942_2340 GTP-binding protein EngA (Synechococcus elongatus PCC 7942)
MPLPIVAILGRPNVGKSTLVNRLAGSREAIVHDEPGVTRDRTYQEAFWCDRDFTVVDTGG
LVFDDDTEFLPLIREQAELALAEAALAVLVVDGQAGLTAADNEIADWLRHQNRPIVVAVN
KCESPDKGAAQAAEFWSLGFGEPLPISSIHGSGTGELLDRVLELLPPADEAAGDETEIGV
AIVGRPNVGKSSLLNSFLGEQRAIVSPIAGTTRDAIDTVIERNDQRYRLVDTAGIRRKRG
VDYGPEFFGINRSFKAIRRADVCLLVIDVLDGVTDQDQKLAGRIEEDGRACVIVVNKWDA
HEKDSSTIYEVERQLRDRLYFLDWAPMIFVSALTGQRVEKILDQVNTVVEQHRRRVGTSV
INEVLGDAIAWRTPPTTRQGRQGRIYYGTQVTTQPPSFTLFVNDPKLFGESYRRYIERQF
RESLGFSGTPIRLFWRGKKSRELERGANRATRV