Protein Info for Synpcc7942_2299 in Synechococcus elongatus PCC 7942
Name: rpsO
Annotation: 30S ribosomal protein S15
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS15_SYNP6: 30S ribosomal protein S15 (rpsO) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
KEGG orthology group: K02956, small subunit ribosomal protein S15 (inferred from 100% identity to syc:syc1801_c)MetaCyc: 46% identical to 30S ribosomal subunit protein S15 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S15p (S13e)" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q31KU0 at UniProt or InterPro
Protein Sequence (89 amino acids)
>Synpcc7942_2299 30S ribosomal protein S15 (Synechococcus elongatus PCC 7942) MSLTQARKQEIFEAYQIHPTDTGSADVQVAVLSERISRLSQHLQQNKKDFASRTGLLRLI GQRKRLLAYILKQDRDRYKALIERLGIRG