Protein Info for Synpcc7942_2282 in Synechococcus elongatus PCC 7942

Annotation: GAF sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 PF10069: DICT" amino acids 4 to 127 (124 residues), 114 bits, see alignment E=1.7e-36 PF17150: CHASE6_C" amino acids 139 to 216 (78 residues), 77.1 bits, see alignment E=4.5e-25 PF01590: GAF" amino acids 243 to 384 (142 residues), 53.3 bits, see alignment E=1.5e-17 PF13185: GAF_2" amino acids 243 to 384 (142 residues), 35 bits, see alignment E=5.7e-12 PF13492: GAF_3" amino acids 243 to 384 (142 residues), 32.7 bits, see alignment E=3.2e-11 PF00512: HisKA" amino acids 400 to 466 (67 residues), 49.4 bits, see alignment E=1.3e-16 PF02518: HATPase_c" amino acids 514 to 626 (113 residues), 102.1 bits, see alignment E=8.7e-33

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to syf:Synpcc7942_2282)

Predicted SEED Role

"sensory transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KV7 at UniProt or InterPro

Protein Sequence (637 amino acids)

>Synpcc7942_2282 GAF sensor signal transduction histidine kinase (Synechococcus elongatus PCC 7942)
MADSTLAQLLEILRQQSFVDLPRPQIYFKASLTALSHALEDLVFATDEKPLLIASFQRER
FYRQEAHRYERLAHVTSAQFVLAAAESRFADADTYPAVAFPPSDPLALEWNLVVIGPRTT
GCLICMEKLDRQGPLEPAMDTARRFEGIWTTDRRVVTVAAELLLDRIAELRPDLQAKTES
AIAALPPAEASAPSVETPFAERLLNYLQAGQYKLLKAYRAQARQTRKEQLINTISSAVRQ
SLNPEAVLEIAARELGLSLAANRCLIYACTPETEQILVEHEYRQTETASLGDRLWPLQEN
PLFQQVATDRKAIRLTVDDPEATLPYIQAMRQQWDIAHWLLIPVQYRQELIGMIELHREA
TAEPWDLADQELAEAIATQIGVALIQAQTFRQLENLERTRSNLTAIIGHELRTPLSTVQV
CLESLATEPDMSADLRQVMLQTALDDAERLRLLVQDFLTLSRLESGRIDWHPESLALDEC
VAMAMSGLRSRHQRDSLPSIEQKLPASLPLVRVDGDWLVEVLIKLLDNACKFTSAQGHVS
ITAVVEGDRALRVAITDDGRGIEPDRLEAVFDRFYQEDGALRRSQGGSGLGLAICRQIVE
RLGGHIWAESEGRDRGSCFQFTLPLATRHPQTANALT