Protein Info for Synpcc7942_2266 in Synechococcus elongatus PCC 7942

Annotation: periplasmic polyamine-binding protein of ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13416: SBP_bac_8" amino acids 43 to 318 (276 residues), 54.4 bits, see alignment E=1.7e-18 PF13343: SBP_bac_6" amino acids 82 to 313 (232 residues), 74.3 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K02055, putative spermidine/putrescine transport system substrate-binding protein (inferred from 100% identity to syf:Synpcc7942_2266)

Predicted SEED Role

"Periplasmic binding protein-like II superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KX3 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Synpcc7942_2266 periplasmic polyamine-binding protein of ABC transporter (Synechococcus elongatus PCC 7942)
MFLSRRRFLQASVGLPGLALAGCRSADLQLLLPGNTVPAPILRRFQDRTQITVQLDRAAG
LVDSSRLLLTEDPSRLPNLLGIGDAWLQSAIASGRLAPFNPNHWRHWTSLPQRWRQQLRR
DRQGVPSEAGEIWAAPYRWGTTMIAFRRDRLTSPLQDWTDLWRPELRGQLILPDDPREVI
GLTLKRLGWSYNQANLAEIPQLEPLLAALQQQVKLYSSRNYLQPLLLGDALAAVGWSADI
LAALRRDSRLAAVVPRSGTAIWLDLWVQPQGRVSEVFSDRWIDFGWAPTIATQFSQLGPA
ASPAILTAAAVAPVDANPLQIPPTAVLDKSELILPLPEAVRDRYLALWQTMRQG