Protein Info for Synpcc7942_2236 in Synechococcus elongatus PCC 7942

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF00005: ABC_tran" amino acids 21 to 189 (169 residues), 86 bits, see alignment E=1.6e-27 amino acids 320 to 472 (153 residues), 115.4 bits, see alignment E=1.3e-36 PF08352: oligo_HPY" amino acids 240 to 275 (36 residues), 30.2 bits, see alignment 1.9e-10

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to syc:syc1862_d)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31L03 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Synpcc7942_2236 ATPase (Synechococcus elongatus PCC 7942)
MADPLLEIRQLQICFGEAIALQGLDLVVQPGESVGIVGESGSGKSVACLAIPGLLPKTAR
CSGQIAFRSVAGQSSRDLLTLPERELRQLRGDRLGFIFQEPLSSLNPVFSAGFQLLEAIQ
QHLPLSQAEAQQRVIALLQEVQLIREPSQAAQILRRYPHQLSGGQRQRLMIAIALAANPD
LLLADEPTTALDATVQASVLQLLRRLQQQRQMAMIFVSHDLGVIAEVADRVVVLYRGQVV
EQGRVADVLNSPQHPYTQGLVACRPQINPRSCYLPTVADFLEGQTEPRSLPPRSPATQPL
LQVEQLGITYRGRSTAFQAVQNLSFTLPAGLTLGLVGESGCGKSSLARCLVGLVPASEGQ
IWLDQQPLDLRSSRDRQRLRQTVQMVFQDPAAALDPRWTVGSAILEPLRIKQPRRDRTAD
QRLLKQWLQRVDLPTDIGDRYPHEFSGGQRQRICIARALIGQPRLLICDESVSALDVSVQ
AQILNLLKQLQAELGLTYLFISHDLAVVRYMSDRILVMNQGQLEEDSPTEQLFQRPQSDY
TRRLIAAIPGEVAA