Protein Info for Synpcc7942_2207 in Synechococcus elongatus PCC 7942

Name: truA
Annotation: tRNA pseudouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 15 to 252 (238 residues), 214.7 bits, see alignment E=6.9e-68 PF01416: PseudoU_synth_1" amino acids 20 to 116 (97 residues), 42.9 bits, see alignment E=3.1e-15 amino acids 156 to 258 (103 residues), 65.8 bits, see alignment E=2.3e-22

Best Hits

Swiss-Prot: 100% identical to TRUA_SYNP6: tRNA pseudouridine synthase A (truA) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 100% identity to syc:syc1890_d)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31L32 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Synpcc7942_2207 tRNA pseudouridine synthase A (Synechococcus elongatus PCC 7942)
MAIAEEPAQAPVIQRIALVIQYLGQGFCGWQRQPRQRSVQGELESAIAAVVGHPVSVQSA
GRTDTGVHAAAQVAHFETTSPIPAHRWPSVLNGRLTPDLNIRAAAIVPANWHARFSASYR
RYRYTIYTDPCPNLFLNSYVWHYYQAPLCENQMQAALQTLVGYHHLAAFQRSGSKRQHAW
VHVQDAWVRRRDSLIEIEVQASGFLYGMIRLLVGLLVQVGEGSRSLESFTDIWVNQRRDR
VRHAAPPQGLCLLRIGYPDSPFPVDAWFDTQPLFVLPASRNDSESLSPCAVSLG