Protein Info for Synpcc7942_2186 in Synechococcus elongatus PCC 7942

Name: nha7
Annotation: probable Na+/H+-exchanging protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 signal peptide" amino acids 21 to 21 (1 residues), see Phobius details transmembrane" amino acids 22 to 39 (18 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 193 to 218 (26 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 348 to 367 (20 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 419 to 434 (16 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 12 to 389 (378 residues), 109.1 bits, see alignment E=2.3e-35 PF00582: Usp" amino acids 419 to 536 (118 residues), 51.5 bits, see alignment E=1.6e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_2186)

Predicted SEED Role

"Na+/H+-exchanging protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31L53 at UniProt or InterPro

Protein Sequence (545 amino acids)

>Synpcc7942_2186 probable Na+/H+-exchanging protein (Synechococcus elongatus PCC 7942)
MLANWIGILLGGFLAGQIARRLGAPALIGMILWGIVLGPQVSQWLSPAVLDQAGIWRTLA
VMVILVKAGLGLERDKLVQQGSVALRLGILPAACEAVVIAIAAHYLLNFDWLTGLLLGCV
IGAESPAVIVPGMLRLKQLGLGVRKGIPDAILTGSALSDVLLLLVFSLLLALLTQGNAHI
WTLPGLGPVNPWLLLPLQVLLQVSLGAVLGFVVARLLVRMLGPQNWTQTLTQDTLVTAAI
ALGLVLAAEQLPIFSGYLAVMVLGYFVVELDAPLARRLRQGFDSLWAIAQIALFVLLGAG
LPLTALASLWLPGLLILVLGTLLGRSIGWALSTWGSNWNWQERSFLLAGNSAKATVQAAI
GGVPLAAGLPEGQSILAIAVLSIVITAPLGAWAIPTFAPRLLSRDPVDPSQVSRDRPVRL
LAAVDSSPVAIAVLLKTAELARRSDAEVAVLHVAQVSDTQSLQTLQRQIEQSLADIRYQF
WLREGAIPETINRCAQEWQADEIILGKHEQSHRPEMRLGSVSQALLDVSTVPMILVETAA
ELQTS