Protein Info for Synpcc7942_2177 in Synechococcus elongatus PCC 7942

Name: natD
Annotation: integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details amino acids 52 to 94 (43 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 233 to 261 (29 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 19 to 286 (268 residues), 176.3 bits, see alignment E=3.7e-56

Best Hits

KEGG orthology group: K11956, neutral amino acid transport system permease protein (inferred from 100% identity to syf:Synpcc7942_2177)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31L62 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Synpcc7942_2177 integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD (Synechococcus elongatus PCC 7942)
LHRALGMASPDLSQLAQLAINGLATGSLLALAATGLTLIYGILRLTNFAQGEFLTLGAYF
TLVANSLGLSLWLAIPLGAIATIALCLLGEAVLWEPLRRQRVNTTTLIILTIGLSLFLRN
LVILIWGAGNQAYRLAVQPALTLWGLRITLNSLLVVIGAAAALVLLHWVLQRTSIGKGMR
AIADDPDLARVSGVPVETVIRWTWVIAGGLTAIAGGLYGLITAVRPTMGWNLILPLFASA
ILGGIGSPYGAIAGGLILGFAQELSTYWLPAEYKLAVAFVILIGVLVIRPQGLFAR