Protein Info for Synpcc7942_2139 in Synechococcus elongatus PCC 7942

Annotation: probable glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF02798: GST_N" amino acids 4 to 76 (73 residues), 49.3 bits, see alignment E=1.5e-16 PF13417: GST_N_3" amino acids 6 to 76 (71 residues), 34.9 bits, see alignment E=4.9e-12 PF13409: GST_N_2" amino acids 11 to 76 (66 residues), 44.1 bits, see alignment E=7.9e-15 PF00043: GST_C" amino acids 109 to 193 (85 residues), 34 bits, see alignment E=8.3e-12 PF13410: GST_C_2" amino acids 124 to 187 (64 residues), 32.4 bits, see alignment E=2.4e-11 PF14497: GST_C_3" amino acids 128 to 194 (67 residues), 24.6 bits, see alignment E=7.4e-09

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to syf:Synpcc7942_2139)

Predicted SEED Role

"Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LA0 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Synpcc7942_2139 probable glutathione S-transferase (Synechococcus elongatus PCC 7942)
MYKVFGDMLSGNCYKIKLLMQFIDMPHQWVHVDILANETHTKEFKRMNPNARIPVVELDD
GKYLWESNAILNYLAEGTEFLPQEKYERAKVLQWQFFEQYSHEPYIATARYINKYLGLPK
EREAEYHAKQAGGHKALTVMEQHLAENRFFLGVNASIADISLYAYTHVAHEGGFDLSEYK
NIQRWFKDFESIPGYVKMARENA