Protein Info for Synpcc7942_2129 in Synechococcus elongatus PCC 7942

Annotation: iron-sulfur cluster binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF09383: NIL" amino acids 3 to 70 (68 residues), 58.1 bits, see alignment E=3.3e-19 PF12837: Fer4_6" amino acids 77 to 99 (23 residues), 31.9 bits, see alignment 4.5e-11 PF13237: Fer4_10" amino acids 77 to 126 (50 residues), 29.4 bits, see alignment E=3.2e-10 PF00037: Fer4" amino acids 77 to 100 (24 residues), 35 bits, see alignment 4.3e-12 PF12797: Fer4_2" amino acids 77 to 96 (20 residues), 26.8 bits, see alignment 1.7e-09 PF14697: Fer4_21" amino acids 78 to 130 (53 residues), 35.4 bits, see alignment E=4.7e-12 PF13187: Fer4_9" amino acids 83 to 130 (48 residues), 31.3 bits, see alignment E=8.2e-11 PF12838: Fer4_7" amino acids 83 to 129 (47 residues), 37.5 bits, see alignment E=1.3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_2129)

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LB0 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Synpcc7942_2129 iron-sulfur cluster binding protein (Synechococcus elongatus PCC 7942)
MKKRVTLTFPRRIVQMPITYRLATEFNVAANIIRAQITPNQSGKLVVELSGDIDALEAAI
DWMGMQDINVSLTTAEIVIDRDRCVDCGLCTGVCPTGALRLDPKSFQLQFDRPRCSVCEQ
CIPTCPVQAIATNL