Protein Info for Synpcc7942_2114 in Synechococcus elongatus PCC 7942

Name: sasA
Annotation: adaptive-response sensory kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF07689: KaiB" amino acids 18 to 98 (81 residues), 56.7 bits, see alignment E=2.5e-19 PF00512: HisKA" amino acids 153 to 222 (70 residues), 32.8 bits, see alignment E=8.6e-12 PF02518: HATPase_c" amino acids 272 to 380 (109 residues), 108.4 bits, see alignment E=4.1e-35

Best Hits

Swiss-Prot: 100% identical to SASA_SYNE7: Adaptive-response sensory-kinase SasA (sasA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K08479, two-component system, OmpR family, clock-associated histidine kinase SasA [EC: 2.7.13.3] (inferred from 100% identity to syc:syc1978_c)

Predicted SEED Role

"Clock-associated two-component sensor histidine kinase SasA" in subsystem Cyanobacterial Circadian Clock

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q06904 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Synpcc7942_2114 adaptive-response sensory kinase (Synechococcus elongatus PCC 7942)
MGESLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVINVADQPQLV
EYYRLVVTPALVKIGPGSRQVLSGIDLTDQLANQLPQWLVQQEAFFADREPPEVNIPFTE
LGQPETPALQQADAFFQLQQQYADLSERTKFLEQVIALVAHDLRNPLTAALLAVDTIQIR
SQSFSVATAKEMQGLCSLFDQARSQLREIERMIAEILEATRHSGESLRINPREVVFEPLL
QQVLEQLHERWRSKQQQLITDVPGDLPTLYADPDRLRQVLVNLLDNAIKYTPPGGTITIA
ALHRTSQKVQISISDTGSGIPRDQLSVIFKNLVRLSRDSSQEGYGIGLSVCQRIVQAHFG
RIWVASELGQGSTFHFTMPVYRYTMPC