Protein Info for Synpcc7942_2113 in Synechococcus elongatus PCC 7942

Name: kprS
Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR01251: ribose-phosphate diphosphokinase" amino acids 23 to 331 (309 residues), 425.2 bits, see alignment E=5.9e-132 PF13793: Pribosyltran_N" amino acids 23 to 138 (116 residues), 173.2 bits, see alignment E=2.5e-55 PF00156: Pribosyltran" amino acids 174 to 268 (95 residues), 65.2 bits, see alignment E=6.8e-22 PF14572: Pribosyl_synth" amino acids 221 to 331 (111 residues), 92.3 bits, see alignment E=5.9e-30

Best Hits

Swiss-Prot: 100% identical to KPRS_SYNE7: Ribose-phosphate pyrophosphokinase (prs) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 99% identity to syc:syc1979_c)

MetaCyc: 50% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q59988 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Synpcc7942_2113 ribose-phosphate pyrophosphokinase (Synechococcus elongatus PCC 7942)
VIRSATLPFASALPSLPDNHRLRLFSGSSNSALSQEVSRYLGIDLGPMIRKRFADGELYV
QIQESIRGCDVYLMQPTCWPVNDHLMELLIMIDACRRASARQITAVLPYYGYARADRKTA
GRESITAKLVANLITQAGANRVLAMDLHSAQIQGYFDIPFDHVYGSPVLIDYLRSKNLAD
LVVVSPDVGGVARARAFAKKLDDAPLAIIDKRRQAHNVAEVLNVIGDVQGKTAVLVDDMI
DTAGTICEGARLLRKQGASQVYACATHAVFSPPAIERLSASGLFEEVIVTNTIPIPEENR
FPQLTILSVANLLGETIWRIHEESSVSSMFR