Protein Info for Synpcc7942_2099 in Synechococcus elongatus PCC 7942

Name: rfbD
Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 285 (285 residues), 309.8 bits, see alignment E=3.2e-96 TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 2 to 284 (283 residues), 306.5 bits, see alignment E=7.9e-96 PF01370: Epimerase" amino acids 3 to 173 (171 residues), 73.7 bits, see alignment E=3.3e-24 PF16363: GDP_Man_Dehyd" amino acids 33 to 146 (114 residues), 43.5 bits, see alignment E=6.1e-15 PF02719: Polysacc_synt_2" amino acids 35 to 137 (103 residues), 22 bits, see alignment E=1.7e-08

Best Hits

Swiss-Prot: 40% identical to RMLD_AGGAC: dTDP-4-dehydrorhamnose reductase (rmlD) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to syc:syc1994_c)

MetaCyc: 40% identical to dTDP-6-deoxy-L-talose 4-dehydrogenase (NAD+) (Aggregatibacter actinomycetemcomitans)
RXN-13749 [EC: 1.1.1.339]

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133 or 1.1.1.339

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LE0 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Synpcc7942_2099 dTDP-4-dehydrorhamnose reductase (Synechococcus elongatus PCC 7942)
MKVLLTGAAGQVGQALQRSHPDGVDLIACGRQQLDLSDESAIRAAIQTLRPDWVINAGAY
TTVDRAESEPALAIAINSNSVRILAESLAETGGNLLQISTDFVFNGDRNRPYPTDAERQP
LSVYGTTKAAAEEAILQFLPERSLIVRTAWVYGLGGRNFVTTMLRLMAERDHLTVVWDQV
GTPTWTDSLAAALWQAIAQNLMGIHHCTDAGVASWYDFAVAIQDLALELGLLQQAVPIAA
IPSSDYPTPATRPAYSVLDCADFNRAIGHDPLHWRHALAQMLTQVAKNQ