Protein Info for Synpcc7942_2093 in Synechococcus elongatus PCC 7942

Name: chpY
Annotation: CO2 hydration protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01964: CO2 hydration protein
  • amino acids 14 to 425 (412 residues), 746.7 bits, E=3.2e-229
• PF10216: ChpXY
  • amino acids 20 to 414 (395 residues), 529.1 bits, E=2.8e-163

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc2000_c)

MetaCyc: 100% identical to CO2 hydration protein CupA (Synechococcus elongatus PCC 7942 = FACHB-805)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Low-affinity CO2 hydration protein CphX" in subsystem CO2 uptake, carboxysome

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• 3-hydroxypropanoate cycle (4/13 steps found)
• glyoxylate assimilation (3/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (4/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (4/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See Q8VPV7 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Synpcc7942_2093 CO2 hydration protein (Synechococcus elongatus PCC 7942)
MTVTTRTTPLPPSQHRFAEVIHRLEAGGSMLPDTPDNLKQIIGIYKAYAVPMDFYWRDLL
YIAEQVFLNPIPAFKYFISQEYLDRPNSYAGDNADLRIWRGPATAHPELLEFMQKGELKR
KLPKWLHHLWHDRVNMEFAEACMDAMLWHQGMGGRFNDYLESEEYRQNADRAIRAYFQGN
PLMLGLYKLFPEMFLEQVRMLSYTANLGLFWEVMAPVFFEMSDIYDEGGFKGVPDAMNFL
VNGIFAIAGRPIYHHVFINGECFEIIPKSAGFTWLYEAALPYVEAVFYRTAPFRGTKSYN
AQAQQVPDQQADFHYGILYADVFPVGSAGIPPTLLMQDMLHFLPPYLLEEYRQHCRGEDD
MLIQLGVTFQRSMYNVTSAVIQALRAALLYPLDDTDPVHLQANRAFFEAQMDRFLRPEAR
LPDIQSQDYR