Protein Info for Synpcc7942_2091 in Synechococcus elongatus PCC 7942

Name: ndhF3
Annotation: NAD(P)H-quinone oxidoreductase subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details amino acids 448 to 470 (23 residues), see Phobius details amino acids 482 to 503 (22 residues), see Phobius details amino acids 531 to 549 (19 residues), see Phobius details amino acids 559 to 569 (11 residues), see Phobius details amino acids 582 to 603 (22 residues), see Phobius details TIGR01960: NAD(P)H dehydrogenase, subunit NdhF3 family" amino acids 1 to 594 (594 residues), 772.3 bits, see alignment E=1.7e-236 PF00662: Proton_antipo_N" amino acids 70 to 120 (51 residues), 42.9 bits, see alignment 3.7e-15 PF00361: Proton_antipo_M" amino acids 138 to 420 (283 residues), 170.2 bits, see alignment E=6.3e-54

Best Hits

KEGG orthology group: K05577, NADH dehydrogenase I subunit 5 [EC: 1.6.5.3] (inferred from 100% identity to syf:Synpcc7942_2091)

MetaCyc: 100% identical to ferredoxin-plastoquinone oxidoreductase subunit F3 (Synechococcus elongatus PCC 7942 = FACHB-805)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"NADH dehydrogenase subunit 5, Involved in CO2 fixation" in subsystem CO2 uptake, carboxysome

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 4.2.1.1

Use Curated BLAST to search for 1.6.5.3 or 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8VPV9 at UniProt or InterPro

Protein Sequence (612 amino acids)

>Synpcc7942_2091 NAD(P)H-quinone oxidoreductase subunit F (Synechococcus elongatus PCC 7942)
MLSAASQSVWLIPGYSLFGAIASLLWSPGLIRLTGPRPSGYVNVIASGVAFLHSLLALWA
MQPAQGSFRWLNTVGFELSFDWSSTTAALVALTVITGLTWFSQIYAIGYLERDWGWARFF
GYLSLFEAGLSGLVLCDSLFFSYVILEMLTLGTYLIVGYWYNQPLVLTGARDAFLTKRIG
DLILLVGVLGLLPLAGTWNFDQLAEWASTAEPSLALTAIAIALIAGPLGKCAQFPFHLWL
DEAMEGPLPSTILRNAIVVVSGAWVLIRIQPIIAAVPVAETLLISVGVVTAICASLIAIA
QVDVKRALSYLVSTWMGLVFIAVGAGQTIAAERLLLVYSLSMALLMMSVGTIVIRNISQD
ITQLGGLWSRRPLPALAFALGGLSLLAMPPFGGFWAWLGLAEGLWPVSPWLVIVLVFVLA
AVGFGLARIFARIWGGPSKAMSVRSAEVLWLMVLPMLVLAGLTLHLPILLAQAGLLPQLN
NLAIPLVWASLVGVATGTVVYYGPARNQPVQLPWQGLQNFFAQDFYTPILYRRTIVASVS
FVATVLQFLDRTIVDGTATLMGLITLGSGQGLRYNVSGRTQGYALTMLLAIAVGSVFFLM
PFLRQSFVLGLL