Protein Info for Synpcc7942_2083 in Synechococcus elongatus PCC 7942

Annotation: Multiple antibiotic resistance (MarC)-related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 5 to 207 (203 residues), 134.6 bits, see alignment E=1.9e-43 PF01914: MarC" amino acids 6 to 209 (204 residues), 155.1 bits, see alignment E=8.2e-50

Best Hits

Swiss-Prot: 34% identical to Y540_AQUAE: UPF0056 membrane protein aq_540 (aq_540) from Aquifex aeolicus (strain VF5)

KEGG orthology group: None (inferred from 100% identity to syc:syc2010_c)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LF6 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Synpcc7942_2083 Multiple antibiotic resistance (MarC)-related proteins (Synechococcus elongatus PCC 7942)
MNWPLVLNFAVALFAVTNPLGNLPIFISYVGKEKPSVQRLLALFLVLTVFISQLVFLLSG
TAILRFFGISLAAFRIAGGIILLLIGINMIQGDRTKANQKLADIGIKSAFRRAETVYQSF
FIPLGIPIFVGPASISTAVLYGNLANNLATNLGLIGAVIAICIVSWLTLSVASWFERILG
DLGLEITSRLLGLMLAAIGVQFILNGLGEATIGFINRAIINSP