Protein Info for Synpcc7942_2076 in Synechococcus elongatus PCC 7942

Name: rsgA
Annotation: ribosome-associated GTPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details TIGR00157: ribosome small subunit-dependent GTPase A" amino acids 47 to 283 (237 residues), 238.9 bits, see alignment E=3e-75 PF03193: RsgA_GTPase" amino acids 70 to 234 (165 residues), 186.4 bits, see alignment E=4e-59 PF01926: MMR_HSR1" amino acids 171 to 235 (65 residues), 26.3 bits, see alignment E=7.1e-10

Best Hits

Swiss-Prot: 59% identical to RSGA1_NOSS1: Small ribosomal subunit biogenesis GTPase RsgA 1 (rsgA1) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 100% identity to syf:Synpcc7942_2076)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LG3 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Synpcc7942_2076 ribosome-associated GTPase (Synechococcus elongatus PCC 7942)
MTAALAGTVVAVQANFYRVQLHHPPANQPAMLLCTRRTRLLKTGQRVMVGDRVWVEEPDW
QGQRGAIASVEPRSSELDRPAIANVDQILLVFAVAEPELEPLQLTRFLVTAESTGIPVQL
CLSKCDLVTAGAIAAWQERLAQWGYQPLWLSQNQPERWPLLLKQLIGRMTVVAGPSGVGK
SSLINRLIPDLELRTAKVSGKLGRGRHTTRHVELFELPQGGLLADSPGFNQPELICSDRE
LAQYFPEIRQRLAADRCQFHDCRHLEEPGCSIRGDWERYSHYQDLLEEAIAQTQQQNRST
QEDVGFKRKSADGGKLRYEPKLQSRRYRRDSRRSQHQSVAEALHNAELED