Protein Info for Synpcc7942_2052 in Synechococcus elongatus PCC 7942

Annotation: probable oligopeptides ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 90 to 116 (27 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 209 to 234 (26 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 289 (184 residues), 91.2 bits, see alignment E=3.5e-30

Best Hits

Swiss-Prot: 31% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to syc:syc2041_d)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LI7 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Synpcc7942_2052 probable oligopeptides ABC transporter permease protein (Synechococcus elongatus PCC 7942)
MQLAVLDRLRLPGFTGATFAARLARWGLGISLIYVLIAIAAPLLQAWGWLQNPTEALLNP
IHAAPSWQHWFGTTRQGYDVFSRTLFGTRVALQVVLLGTSLSLVIGVPLGLIAGYWGGWL
DRALVFLMDVIYTLPGLLLSITLAFVVGRGVPNAAIALSIAYVPQYFRVVRNQTASVKSE
PYIEAARSLGASTPHILRKYLVANVIQSVPVLFTLNAADAVLILGGLGFLGLGLPEAVPE
WGYDLRQALDALPTGIWWTALFPGLAMTLLVVALSLLGEGLGETLQPKRR