Protein Info for Synpcc7942_2022 in Synechococcus elongatus PCC 7942

Name: nusA
Annotation: transcription elongation factor NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR01953: transcription termination factor NusA" amino acids 11 to 371 (361 residues), 336.9 bits, see alignment E=6.2e-105 PF08529: NusA_N" amino acids 11 to 141 (131 residues), 96.1 bits, see alignment E=1.8e-31 PF13184: KH_5" amino acids 261 to 327 (67 residues), 97.4 bits, see alignment E=4.1e-32

Best Hits

Swiss-Prot: 39% identical to NUSA_THET8: Transcription termination/antitermination protein NusA (nusA) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 100% identity to syf:Synpcc7942_2022)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LL7 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Synpcc7942_2022 transcription elongation factor NusA (Synechococcus elongatus PCC 7942)
MSMVTLPGLEQLIYAISEQKKLPANVIEEALKEALLKGYERYRRTQQMGEQFEEDYFDNI
DVELDVEQEGFRVLATKTIVNQVENPDHQIALADVQEVAPDAQAGEIVVLDVTPDKDDFG
RMAAIQTKQVLSQKLRDHQRKLIQEEFQDLEDPVLMAKVLRFERQSVILGVSSGLGRPEV
EAELPRREQLPNDNYRANATFRVFLKEVSEVPRRGPQLIVSRANAGLVVYLFENEVPEIQ
DGVVRIVAVAREANPPTRHVGPRTKIAVDTLEREVDPVGACIGARGSRIQVVVNELRGEK
IDVIRWSPDPATYIANALSPARVQEVRLVDPEGRIAHVLVNDDQLSLAIGKEGQNVRLAA
RLTGWKIDIKDVALYDAVTEGQRISELIQERQERAAIAAEEEARAAAEAAELAEWEAEEA
ALAAAEAAAELAAAEAEEETV