Protein Info for Synpcc7942_2011 in Synechococcus elongatus PCC 7942

Name: ycf56
Annotation: Ribonuclease Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF23023: Anti-Pycsar_Apyc1" amino acids 1 to 99 (99 residues), 43.1 bits, see alignment E=6.8e-15 TIGR02651: ribonuclease Z" amino acids 2 to 305 (304 residues), 376.9 bits, see alignment E=3.2e-117 PF00753: Lactamase_B" amino acids 22 to 76 (55 residues), 31.9 bits, see alignment 1.9e-11 PF12706: Lactamase_B_2" amino acids 34 to 151 (118 residues), 35.5 bits, see alignment E=1.2e-12 amino acids 200 to 269 (70 residues), 33 bits, see alignment E=6.9e-12

Best Hits

Swiss-Prot: 64% identical to RNZ_SYNY3: Ribonuclease Z (rnz) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00784, ribonuclease Z [EC: 3.1.26.11] (inferred from 100% identity to syf:Synpcc7942_2011)

Predicted SEED Role

"Ribonuclease Z (EC 3.1.26.11)" in subsystem tRNA processing (EC 3.1.26.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31LM8 at UniProt or InterPro

Protein Sequence (393 amino acids)

>Synpcc7942_2011 Ribonuclease Z (Synechococcus elongatus PCC 7942)
LQVTFLGTSSGVPTRSRNVSAVALRLPQRAEVWLFDCGEGTQHQFLRSELRISQLRRIFV
THMHGDHVFGLMGLLASVGLAGNPERIDLYGPKPLRDYLQACAQHSRTHINYPLQIATVQ
PGVIYEDAEIVVSCAPLHHRVPAFGYRIQERDRPGRFDVEKARSLGIPPGPIYKQLKDGE
TVTLEDGRQIDGRQLCGPTERGRSMVYCTDTIFCESAIALAQDADVLIHESTFSDRDREM
AEQRLHATATMAAEVAKQAGVRQLILTHFSPRYAPGNEQTLDDLLAEAQAIFPQTMLAKD
FLSYDVPRRLAADADEPTEVPAVAKSPSQPEPSAIVPDSRRKPQITKEVLVARFSGEGEP
AHRAAYRYLRETCGVTPKGRSWEAVLAAFNSLD