Protein Info for Synpcc7942_1956 in Synechococcus elongatus PCC 7942

Name: accD
Annotation: acetyl-CoA carboxylase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 1 to 287 (287 residues), 450 bits, E=1.7e-139
• PF17848: zf-ACC
  • amino acids 30 to 55 (26 residues), 42.8 bits, see alignment (E = 4.9e-15)
• PF01039: Carboxyl_trans
  • amino acids 97 to 247 (151 residues), 73.4 bits, E=1.5e-24

Best Hits

Swiss-Prot: 100% identical to ACCD_SYNP6: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 100% identity to syc:syc2139_c)

MetaCyc: 50% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (37/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• propanoyl CoA degradation I (1/3 steps found)
• 2-oxobutanoate degradation I (1/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (4/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• 3-hydroxypropanoate cycle (4/13 steps found)
• glyoxylate assimilation (3/13 steps found)
• superpathway of L-methionine salvage and degradation (5/16 steps found)
• methylaspartate cycle (7/19 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (4/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (4/18 steps found)
• superpathway of mycolate biosynthesis (15/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

See Q54776 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Synpcc7942_1956 acetyl-CoA carboxylase subunit beta (Synechococcus elongatus PCC 7942)
MSLLDWFANRRKTEPVVHDYQEREIADGLWTKCESCDALTYTKDLQANLMVCLQCGHHLR
IYSDERIRQLIDPGTWQFLDEAVSPTDPLGFRDRKSYSDRLKETQANTGLSDAVRTGVGL
LEGQPVALGVMDFRFMGGSMGSVVGEKLTRLIEKGTEQRSPVIIVCASGGARMQEGMLSL
MQMAKISGALERHREAGLLYLPILTHPTTGGVTASFAMLGDLIIAEPKALIGFAGRRVIE
QTLREKLPDDFQTAEYLQAHGFVDTIVPRTQLKKTLAQLIRLHQPQSPEMKLPLLESSSP
ATAPL