Protein Info for Synpcc7942_1933 in Synechococcus elongatus PCC 7942

Name: fni
Annotation: isopentenyl pyrophosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02151: isopentenyl-diphosphate delta-isomerase, type 2
  • amino acids 13 to 341 (329 residues), 394.5 bits, E=1.7e-122
• PF01070: FMN_dh
  • amino acids 183 to 325 (143 residues), 62.5 bits, E=3.6e-21
• PF01645: Glu_synthase
  • amino acids 253 to 306 (54 residues), 25.6 bits, 6.7e-10

Best Hits

Swiss-Prot: 100% identical to IDI2_SYNP6: Isopentenyl-diphosphate delta-isomerase (fni) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 100% identity to syc:syc2161_c)

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 5.3.3.2)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• all-trans-farnesol biosynthesis (3/4 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• methylerythritol phosphate pathway I (6/9 steps found)
• isoprene biosynthesis I (6/10 steps found)
• bisabolene biosynthesis (engineered) (3/6 steps found)
• mono-trans, poly-cis decaprenyl phosphate biosynthesis (2/5 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
• mevalonate pathway II (haloarchaea) (1/7 steps found)
• isoprene biosynthesis II (engineered) (1/8 steps found)
• mevalonate pathway III (Thermoplasma) (1/8 steps found)
• mevalonate pathway IV (archaea) (1/8 steps found)
• superpathway of ergosterol biosynthesis II (8/26 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• superpathway of ergosterol biosynthesis I (3/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)
• superpathway of cholesterol biosynthesis (3/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Sequence Analysis Tools

See Q31LV6 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Synpcc7942_1933 isopentenyl pyrophosphate isomerase (Synechococcus elongatus PCC 7942)
VNFPIAAESSLPQRKAEHLQLCLEAGVESPEVTTGLERYRFQHCALPNLSLQALDLGTQF
LGRSLGAPLLISSMTGGTETAQRINCRLAIAAQKYRLAMGVGSQRVMLRQPETTPTFDVR
DLAPDILLLANLGAVQLNYGVTPAEAQQLVDRLGADALILHLNPLQECIQAEGDTDFRGL
LGRIGELCAALSVPVIVKEVGNGLSAMVAAQLLSAGVAALDVAGAGGTSWSRVEGQRAVD
PLLRRLGDRFGDWGIPTAESLQQVRQVSATVPLIASGGIRHGLDAAKAIALGADLVGLAR
PFLVAADQSEEVLDQWITELLAELRIVRFCTDSGDWAALRRPGVLRPC