Protein Info for Synpcc7942_1877 in Synechococcus elongatus PCC 7942

Annotation: Transglutaminase-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 20 to 48 (29 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 545 to 572 (28 residues), see Phobius details PF11992: TgpA_N" amino acids 16 to 328 (313 residues), 201.1 bits, see alignment E=3.7e-63 PF01841: Transglut_core" amino acids 364 to 471 (108 residues), 87.2 bits, see alignment E=1.4e-28 PF13559: DUF4129" amino acids 588 to 657 (70 residues), 42.4 bits, see alignment E=8.9e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc2217_d)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31M12 at UniProt or InterPro

Protein Sequence (667 amino acids)

>Synpcc7942_1877 Transglutaminase-like (Synechococcus elongatus PCC 7942)
MTAAVWCPPRLGLCLLSGGYLIALLLQLGDLPPVAAFVAITLLIWGLIRQWQQRSLLPQT
LRHGLTAIALILALLVGLPQGLLSVFLGLLTLAFALKLLELKEERDYQALVLIAYSLVAL
GFLLRQSLLETLVLLMAIALATLGLAALYRPLSRPRQPFAALLRLLGPAIPLLLVLFLIA
PRLPPLWGVPVGQRAVTGLSDRVSPGEIADLSRSSALAFRFSFPEASLPSDRFYWRAMVH
ELTDGRSWQPLPYRDRFDPGEVAPELTGEGAIPYTVIAEPSQRTWRYALELSRPTSEGIV
LDSRFEFRTKIPLSQQSRYQGVTFERYQADLTLSARDRQLNLQLPPGSNPQTRAWAQRLR
DRFSNDDAAIVQASLQELQQQEFRYTLQPPLLTANNSIDDFLFRSRAGFCEHYASSFAFL
MRAAGLPARVVTGYLGGEWNPQASYYSVLQANAHAWTEVWLEGQGWTRIDPTAAIAPLRL
SEGLEAALTPEDRAQAAGGLLGAAVLRRLPLLDQAWQLWASIDYRWTSWVLSYDNQRQQE
ILAALLAQVGQVGLSLLLVATLLIAAGLMWWLSRWLDQRSSEDPSLRIYQQACRTIAKAG
WPRYPQEGPAAYAERLQQLQQPWTAVFSQLTQQYLAQRYAQQSLPAQSLQRSLQALRRSL
RVKTRSS