Protein Info for Synpcc7942_1841 in Synechococcus elongatus PCC 7942

Name: murF
Annotation: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01225: Mur_ligase
  • amino acids 31 to 77 (47 residues), 40.1 bits, 5.8e-14
• TIGR01143: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  • amino acids 34 to 448 (415 residues), 417.9 bits, E=2.4e-129
• PF08245: Mur_ligase_M
  • amino acids 115 to 294 (180 residues), 145.3 bits, E=3.7e-46
• PF02875: Mur_ligase_C
  • amino acids 313 to 392 (80 residues), 36.3 bits, E=8.6e-13

Best Hits

Swiss-Prot: 56% identical to MURF_SYNY3: UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (murF) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01929, UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase [EC: 6.3.2.10] (inferred from 100% identity to syc:syc2253_d)

Predicted SEED Role

"UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate--D-alanyl-D-alanine ligase (EC 6.3.2.10)" in subsystem Methicillin resistance in Staphylococci or Peptidoglycan Biosynthesis (EC 6.3.2.10)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• Lysine biosynthesis
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.10

Sequence Analysis Tools

See Q31M48 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Synpcc7942_1841 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase (Synechococcus elongatus PCC 7942)
MATFFSPFQIQLGLGAIPLQVGEACDRPARSLTTDSRQIQPGDIFLALRGDRFDGHDFVA
QALADGAIAAIVDRDYQPPSDLAAGHLLQVDNTLWAYQEVARLWRQRCSLPLIGITGSVG
KTTTKELIAAMLAVRGPVLKTEANYNNEIGVPKTVLQIDPDHHWAAVLEMGMRGRGQIAE
LARIAQPNIAVITNVGTAHIGLLGSEQAIAEAKCELLAQLSGTGLAILNADNHRLIATAQ
RLNLPRCRTYGLQNGDLQGQLIDLETLVVEGQRFRLPLPGAHNALNFLAGLAIAQELGLD
WEAFRDLSVTLPQGRARRIELSPDIVLLDETYNAGLESMLAALQLLADTPGQRRIAVLGT
MKELGDFSETYHRQVGEKAAALGLDRLLIYADPTEAAAMQAGASAIATQIFTNAEDLLSE
LRQSVQTGDRLLFKASRSVALDRILADFVAVYSAV