Protein Info for Synpcc7942_1741 in Synechococcus elongatus PCC 7942

Name: murC
Annotation: UDP-N-acetylmuramate--L-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01082: UDP-N-acetylmuramate--L-alanine ligase
  • amino acids 12 to 467 (456 residues), 486.9 bits, E=3.6e-150
• PF01225: Mur_ligase
  • amino acids 12 to 117 (106 residues), 70.8 bits, E=1.5e-23
• PF08245: Mur_ligase_M
  • amino acids 123 to 297 (175 residues), 69 bits, E=8.6e-23
• PF02875: Mur_ligase_C
  • amino acids 318 to 409 (92 residues), 53.8 bits, E=2.9e-18

Best Hits

Swiss-Prot: 100% identical to MURC_SYNE7: UDP-N-acetylmuramate--L-alanine ligase (murC) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to syf:Synpcc7942_1741)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

See P95836 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Synpcc7942_1741 UDP-N-acetylmuramate--L-alanine ligase (Synechococcus elongatus PCC 7942)
MTIAVDLQGRPFHFIGIGGIGMSALAQVVTERQLPVSGSDIRRSHITDRLAQLGAQIFDR
QAATNLEFFQEAVSAGQSPQVICSTAIHAHNEEYQAAIDLGCPVFHRSDLLAALLRVYES
IAVAGTHGKTTTSGLIAYLLYQAGLDPTVVIGGEVNALGGNARLGQGRHLVAEADESDGS
LVKLQAAIGIITNIELDHPDHYCDLEAVISTFKTFSDNCSQLIANWDCPTVRDRLPGTIS
YSLDPARGADYTVDQVSFRGSGTQARIWERGELLGRIHLPLLEAHNLSNALAAIAACRHL
GMDFASIREGLAGFEGARRRFEFRGSAQGIQFVDDYAHHPSELAATLAAARLQIDSGCSR
LPEVPKRLVAIFQPHRYSRTQAFLAEFAQSFGPADLVLISDIYAAGERNPGQLSGQTLAD
AIAQYQANVHYAPDLEAVEQRLHQLLQPGDLALFLGAGNLNQVIPRLLDHYACDRSAA