Protein Info for Synpcc7942_1735 in Synechococcus elongatus PCC 7942

Name: sufB
Annotation: cysteine desulfurase activator complex subunit SufB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR01980: FeS assembly protein SufB" amino acids 12 to 470 (459 residues), 672.3 bits, see alignment E=1.5e-206 PF19295: SufBD_N" amino acids 139 to 200 (62 residues), 42 bits, see alignment E=8.5e-15 PF01458: SUFBD_core" amino acids 208 to 450 (243 residues), 264.6 bits, see alignment E=7.6e-83

Best Hits

Swiss-Prot: 84% identical to Y074_SYNY3: UPF0051 protein slr0074 (slr0074) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K09014, Fe-S cluster assembly protein SufB (inferred from 100% identity to syc:syc2356_c)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufB" in subsystem Staphylococcal phi-Mu50B-like prophages

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MF4 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Synpcc7942_1735 cysteine desulfurase activator complex subunit SufB (Synechococcus elongatus PCC 7942)
MSATVQALVNQPYKYGFVTDIETEKIAKGLSEEVVRLISAKKEEPEWMLEFRLKAYRRWL
TMEEPDWAAVGYPAIDYQNIVYYAAPKQKAEKKQSLDEVDPTLLETFEKLGIPLSEQKRL
ANVAVDAVFDSVSIATTFREKLAEEGVIFCSISEAVREYPEMVKQYLGSVVPIGDNYFAA
LNSAVFSDGSFVFIPKGVRCPMELSTYFRINSGDTGQFERTLIVAEEGSHVSYLEGCTAP
MFDTNQLHAAVVELVALDDAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGRNSKISW
TQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNCQQADTGTKMVHIGKNTRSTIVSKG
ISAGRSQNSYRGLVKVGPQATGARNYSQCDSMLIGDRAAANTFPYIQVQNAGAQVEHEAS
TSKIGEDQLFYFQQRGISLEDAVSMLISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG