Protein Info for Synpcc7942_1667 in Synechococcus elongatus PCC 7942

Name: murD
Annotation: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21799: MurD-like_N
  • amino acids 4 to 90 (87 residues), 27.4 bits, E=5e-10
• TIGR01087: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • amino acids 5 to 458 (454 residues), 370 bits, E=9.6e-115
• PF08245: Mur_ligase_M
  • amino acids 114 to 298 (185 residues), 86.5 bits, E=3.7e-28
• PF02875: Mur_ligase_C
  • amino acids 319 to 386 (68 residues), 34 bits, E=4.6e-12

Best Hits

Swiss-Prot: 100% identical to MURD_SYNE7: UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K01925, UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC: 6.3.2.9] (inferred from 100% identity to syc:syc2422_c)

Predicted SEED Role

"UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC 6.3.2.9)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.9)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Glutamine and D-glutamate metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.9

Sequence Analysis Tools

See Q31MM2 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Synpcc7942_1667 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase (Synechococcus elongatus PCC 7942)
MQHAHVIGLGKSGCAAALLLRQQGWQVELSDRNAVAAPPELVSQGVQFRLGESLDPVAWG
WQTPEQRPNCIVVSPGVPWDLPGLRQAAEELQIETLGELELAWRTLSDIPWVAVTGTNGK
TTTTALIAAIFERAGLQAPACGNIGFAACEVARQQQQGEAKPLDWVIAEASSYQIEAAAT
LAATIGLWTTFTPDHLNRHYTLENYFTIKASLLDRAQQQVLNGDDPYLRNQANATSRWPL
AFWTSTQGAEALPTSRDRGFWIEEGWVIDRGDRLFPVERFSMVGNHNQQNLLMAVAAARL
AGIEAEAIAEAMANFPGIAHRLERVATWQGIELINDSKATNYDAAWVGLQAVPGPTILIA
GGEAKQGDDQAWLDLIQAKARAVLLIGSAAPLFARRLAEVGYSSPVENAETLDRAVPRAV
ELAQSLDASHVLLSPACASFDQYPNFEARGDHFRRCAQAIAKG