Protein Info for Synpcc7942_1662 in Synechococcus elongatus PCC 7942

Name: cysS
Annotation: cysteinyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 TIGR00435: cysteine--tRNA ligase" amino acids 3 to 477 (475 residues), 569 bits, see alignment E=4.9e-175 PF01406: tRNA-synt_1e" amino acids 16 to 319 (304 residues), 434.3 bits, see alignment E=5.5e-134 PF09334: tRNA-synt_1g" amino acids 36 to 147 (112 residues), 29.8 bits, see alignment E=5.6e-11 PF09190: DALR_2" amino acids 354 to 419 (66 residues), 65 bits, see alignment E=1.4e-21

Best Hits

Swiss-Prot: 100% identical to SYC_SYNE7: Cysteine--tRNA ligase (cysS) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to syc:syc2426_d)

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MM7 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Synpcc7942_1662 cysteinyl-tRNA synthetase (Synechococcus elongatus PCC 7942)
MTLSLYNTLTRQKQRFEPLQAGSVSLYCCGVTVYDYCHLGHARSYIVWDTLRRYLLWLGY
RVRYVQNFTDIDDKILRRSRQEGTTMQAIADRYTQAYFEDMARLNILEADDYPRATHTLD
GIQRLIAELEDKGFAYAADGDVYFSVRRFQDYGKLSGRKLEDLKAGASGRVESAEESLKH
DPFDFALWKAAKPEEPAWDSPWGPGRPGWHIECSAMVRDRLGDSIDIHVGGADLVFPHHE
NEIAQSEAVTGHPLARYWLHNGMVNVGGEKMSKSLGNFTTIRQLLDEGGISPMVLRLFVL
QANYRKPIDFTDEALQACQNGWETLQEGLHFGEHWGDRLGWTESVTVDPDLSDRFRMAMD
DDLNTPAALAVLFELAKELRRQQNLLIHEGHLDGDAQQLHQHWVTLVQLAGVLGLEAEPE
LAETNELDEAAIEDWIAKRHAARQAKDFAEADRIRHYLADLGITLIDQAGGITRWSRT