Protein Info for Synpcc7942_1643 in Synechococcus elongatus PCC 7942

Annotation: diguanylate cyclase with GAF sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details PF01590: GAF" amino acids 27 to 155 (129 residues), 62.8 bits, see alignment E=1e-20 amino acids 189 to 320 (132 residues), 44.6 bits, see alignment E=4.3e-15 PF13185: GAF_2" amino acids 34 to 154 (121 residues), 37.3 bits, see alignment E=6.4e-13 PF13492: GAF_3" amino acids 189 to 322 (134 residues), 28.3 bits, see alignment E=4.2e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 336 to 497 (162 residues), 147.3 bits, see alignment E=1.7e-47 PF00990: GGDEF" amino acids 340 to 495 (156 residues), 144.9 bits, see alignment E=3.7e-46

Best Hits

KEGG orthology group: K02488, two-component system, cell cycle response regulator (inferred from 100% identity to syc:syc2443_c)

Predicted SEED Role

"Phytochrome-like protein; Cph2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MP6 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Synpcc7942_1643 diguanylate cyclase with GAF sensor (Synechococcus elongatus PCC 7942)
MLQCIPTRFEEQRLAALYRYGILDTPPEQHFDDLTQLIAAICEVPIALISLIDRDRQWFK
SRVGLEDDSSPRSTSFCGHAIQQEDLFIVEDAKADPRFVDNPFVTQEPHIRFYAGSPLIT
DDEQILGTLCVIDRKPRHLNDLQQQALRILSRQVIRELELRRSLYQAEHRWSLARFKRRL
GNLVRSSLDLDQICQLAAQELGETLEIDHCSISTCTDASTICSMSHYVRPEQIHRSIQWQ
LPDALVQQALQQDNAITFDQYQSEVIPTVEPPQSLLLVRTSAQDRPNGLISLAHYSSHHH
WNRDEIDLLESVAVQLGLAIEQAQLYRSVQAVNVELHKLAYTDTLTQIPNRRAFDETFAE
LWQTALLQQQSLSLIVADIDLFKTVNDRFGYEQGDRCLKHVAQTLKTGIRQNQDFVARFG
GEEFVLLLPSTDSSGAIAVVAKLQERLANSEADLPVLPTLSYGIATVIPQPQHTPEQLFR
VANQAVRRVKERGRNDFAARLLVAAE