Protein Info for Synpcc7942_1642 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 56 to 73 (18 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details TIGR00341: TIGR00341 family protein" amino acids 49 to 254 (206 residues), 95 bits, see alignment E=2.8e-31 PF04087: DUF389" amino acids 83 to 219 (137 residues), 143.2 bits, see alignment E=2.7e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_1642)

Predicted SEED Role

"FIG01156280: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MP7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Synpcc7942_1642 hypothetical protein (Synechococcus elongatus PCC 7942)
MKLSFGARRQLIRQRRRVQDAVQRNSGRWKWIGGRPVSLPVLNRSLWKIAEPTSDYYLLL
LLSGSIASFGLLANSAATIIGAMIVAPLMGPILAIGYAIVAGNRRLLKRSLLALSTGALL
TVTVAVIIGGILGSIDPGSEIMGRTQPTLLDLGVALAAGATGALAQCRRDIANTLPGVAI
AVALVPPLSVVGLGLALGSLPIAGGSFLLFLTNLVGIILASSGVFLWQNYGTFTRARQGL
MAAVLAMFTLTIPLGLSLQAAVRRAQVVTVAEDVLRSRYSAVTGVRLRDIRVQLQGQTTH
LEIALEAPPDVISANLVDDIRQQMETRLRSPVSLDVRLLLIEQFQSNKSISPSNRR