Protein Info for Synpcc7942_1588 in Synechococcus elongatus PCC 7942

Annotation: CBS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 859 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 150 to 174 (25 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 364 to 388 (25 residues), see Phobius details amino acids 395 to 414 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 64 to 411 (348 residues), 280 bits, see alignment E=4.4e-87 PF00571: CBS" amino acids 439 to 487 (49 residues), 34 bits, see alignment 4.7e-12 amino acids 502 to 554 (53 residues), 53.7 bits, see alignment 3.1e-18 PF00582: Usp" amino acids 586 to 717 (132 residues), 42.5 bits, see alignment E=1.5e-14

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to syf:Synpcc7942_1588)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31MV1 at UniProt or InterPro

Protein Sequence (859 amino acids)

>Synpcc7942_1588 CBS (Synechococcus elongatus PCC 7942)
VFRLRFPPRFAKAQQWAVLEACAIGLVSGASAFLLKLGATGVQDLRDRPGLPLGLQLLLP
PILGAIAGWLVQRFAPEAEGSGISQVQAALSGSRIALNLRVAIVKIASTMLVVGSGLPLG
RQGPTVQVGASLAGQMSQWFPTSPDYRRQLIASGAAAGLAAGFNAPLAGVMLVLEQLLHD
VSSFTLGTAVLAAFIGAVVSGILGSQSLSFSSEIVAAPAALTVPELPVVLLLGLFAGGLG
ILFNRGLAFSQRCYERLPLKGLPWRVAIASGISALLLLLLPAALRQGLSNPFRVTIPDSG
SIALLMLAINFGLTLVAAGSGASGGIFAPALVLGSSLGLGVVLSIQAIFLQVGIPLRIDA
PATYALAGMGAMFSAVTQGPITAIVIVFEMTRDFNAVLPLMVASITAYGIASLARSPSKA
AAVVDALPTLNSSLGLTAAQVMASPVETLEASLPLTEVIQQFNRTHHRGFPVTQKGALVG
IVTSSDLDEQTLKGKGESVRLSEIMTPHPLTVAPQDTLAHVLYVLNRFQISRLPVVDGRK
LVGIITRADIIRAESELLSGQDIAATPIAPSYVAYETRSPATGQGRLLVLLANPRTAQSL
LQLAAGLASLRNYELECLHLIPVSREADPSQTAVSTLGARRMLRQAERLGRRWQIPVHTQ
VRVCHDLSAAILETISDRHINDLVMGWGGGASLAQRLFREGIDQILQQAPCRVLLVKPGA
AFLAKAPLLQGDRPTLPLRHWLIPLSAQVPQTGLAEPLEQILQLITDPDISLCQIDLPRQ
TVSANRLQQLQRRLENRLRQPIQADLICARSVTAVLLDVMQSRGIEAVMLSMTLEQLPTT
TLWKDLLAQAPQTVIIQRR