Protein Info for Synpcc7942_1586 in Synechococcus elongatus PCC 7942

Annotation: periplasmic sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 168 to 190 (23 residues), see Phobius details PF00512: HisKA" amino acids 201 to 267 (67 residues), 66.3 bits, see alignment E=2e-22 PF02518: HATPase_c" amino acids 317 to 428 (112 residues), 105.3 bits, see alignment E=2.4e-34

Best Hits

KEGG orthology group: K11520, two-component system, OmpR family, manganese sensing sensor histidine kinase [EC: 2.7.13.3] (inferred from 100% identity to syf:Synpcc7942_1586)

Predicted SEED Role

"Two-component sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8KPT8 at UniProt or InterPro

Protein Sequence (436 amino acids)

>Synpcc7942_1586 periplasmic sensor signal transduction histidine kinase (Synechococcus elongatus PCC 7942)
MFSATRRRLAIWYTLLTAILLLAFAVSAYVYVRGTLIDRVDDTLNHVVEVIERSLVIEPT
GPSRTPQVNLEISFRSREASAEADRIDLEWFSPSGDLLWSTLDAPLAVPLSLSRRAETVS
FPSAYDEPALVRQLTEPVIFDRQLLGYLRVSHPWFEVSAPTQQLLIDLSFGSALMLVAVA
ATGWFLSGLAMRPVYESYGQLKQFTADASHELRNPIATIQANVQAALTEPQGLAPEQQQV
LQVIERLTRRLGSLVDDLLFLARQDSGLQQPAPIQNLDLDALLLDVVEEQSLYAQEQNLS
LDLQLPDADQALQLTGVREQLARLFTNLIANALQYTPASGQVTVQVQPLNQGLQVEVRDS
GIGISPETLPHVFERFYRADPARRPRDRGGSGLGLAIAQAIVERHHGKIHLRSQVGQGTT
AVVWLPFNQPDAARSL