Protein Info for Synpcc7942_1576 in Synechococcus elongatus PCC 7942

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 28 to 54 (27 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 170 to 195 (26 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 412 to 431 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 86 to 427 (342 residues), 310.8 bits, see alignment E=6.4e-97

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to syf:Synpcc7942_1576)

Predicted SEED Role

"H(+)/Cl(-) exchange transporter ClcA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8KPV0 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Synpcc7942_1576 chloride channel protein (Synechococcus elongatus PCC 7942)
MTPDSHSFVSSLLASRMRFRRFLEASEGLNLVLLWAAIAGLMVGLVGGAFRWLTSATLNG
RVRWLASLPQGPELVASVLLSSGMVALGFYLMRRFAPDTSGSGIPQIEGWLAGFFSLFWW
RVLPVKFLAGILTLGSGMVMGREGPTIQMGGAIGQMVSDWFRASTEQARVLVAASAGAGL
ATAFNAPLAGIVFVFEEMRPTFQNRLRAYQAVTIACITATIGLQLLLGKGPTIELAQFGA
PPLSSLWVFVLLGLACGAIGYSFNRLLVWSLNCFATLHGLPLRLTGLGVGGFIGLVSWLY
PPATNSGENLVLWAFDTVEPIHTLLLLCSLRFALTLLCYGSGAPGGIFAPLLSIATLFSL
GLGQLTIDWLPGLLLPPEVLAIAGMGAFVAATIQSPLTAILLTTEITSNYQLILPIMVSC
SAATLIAHGLGSRPIYTVLLERQLAKAGIAVPTPKAQNGAIDL