Protein Info for Synpcc7942_1554 in Synechococcus elongatus PCC 7942

Name: clpP1
Annotation: ATP-dependent Clp protease proteolytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 86 to 106 (21 residues), see Phobius details TIGR00493: ATP-dependent Clp endopeptidase, proteolytic subunit ClpP" amino acids 1 to 190 (190 residues), 339.2 bits, see alignment E=3.3e-106 PF00574: CLP_protease" amino acids 11 to 190 (180 residues), 292.2 bits, see alignment E=8.2e-92

Best Hits

Swiss-Prot: 100% identical to CLPP1_SYNP6: ATP-dependent Clp protease proteolytic subunit 1 (clpP1) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 100% identity to syf:Synpcc7942_1554)

MetaCyc: 100% identical to ClpP1 (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P54415 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Synpcc7942_1554 ATP-dependent Clp protease proteolytic subunit (Synechococcus elongatus PCC 7942)
MIPIVVEESGRGERAFDIYSRLLRERIIFLGEPVTSDVANRIVAQLLFLEAEDPEKDIYL
YINSPGGSVYDGLGIFDTMNHIRPDVSTVCVGLAASMGAFLLAAGAKGKRTSLAHSRIMI
HQPLGGAQGQAKDIEIQANEILYIKQNLNEVLAERTGQPLSRIEDDTDRDFFMSASEAVE
YGLIDRVIDRRALKATA