Protein Info for Synpcc7942_1525 in Synechococcus elongatus PCC 7942

Name: typA
Annotation: GTP-binding protein TypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF00009: GTP_EFTU" amino acids 4 to 196 (193 residues), 191.4 bits, see alignment E=3e-60 TIGR01394: GTP-binding protein TypA/BipA" amino acids 5 to 595 (591 residues), 965.9 bits, see alignment E=6.7e-295 TIGR00231: small GTP-binding protein domain" amino acids 6 to 134 (129 residues), 78.6 bits, see alignment E=4.5e-26 PF01926: MMR_HSR1" amino acids 8 to 129 (122 residues), 22.9 bits, see alignment E=2e-08 PF03144: GTP_EFTU_D2" amino acids 219 to 289 (71 residues), 39.3 bits, see alignment E=1.8e-13 PF00679: EFG_C" amino acids 398 to 480 (83 residues), 74.8 bits, see alignment E=1.2e-24 PF21018: BipA_C" amino acids 484 to 591 (108 residues), 152.2 bits, see alignment E=1e-48

Best Hits

Swiss-Prot: 83% identical to TYPA_SYNY3: GTP-binding protein TypA/BipA homolog (typA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K06207, GTP-binding protein (inferred from 100% identity to syf:Synpcc7942_1525)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31N14 at UniProt or InterPro

Protein Sequence (597 amino acids)

>Synpcc7942_1525 GTP-binding protein TypA (Synechococcus elongatus PCC 7942)
MSLPIRNVAIIAHVDHGKTTLVDALLKQSGIFREGEDVPDCVMDSNDLERERGITILSKN
TAVKYKDTLINIVDTPGHADFGGEVERVLGMVDGCILIVDANEGPMPQTRFVLKKALEKG
LRPIVVVNKIDRPRAEPMVAVDKVLDLFLELGADDDQCEFPYLFASGLSGFAKESLEDES
KDMQPLFDAILRHVPPPIGDVSKPLQLQVTTLDYSDFLGRIVIGKIHNGTINMGQPTALL
KEDGSVVRGKVTKLLGFEGLKRIEIEQATAGMIVAVAGFADANIGETLACPNEPLALPLI
KVDEPTLQMTFCVNDSPFAGKEGKFVTSRQVRDRLLRELETNVALRVEETDSPDRFMVSG
RGELHLGILIETMRREGYEFQVSQPQVIFREVNGQPGEPFETLVMDVPDDAVGSVIERLG
TRKAEMQNMEAVGNGRTILEFVIPARGLIGFRGDFIRLTRGEGIMNHSFLEYRPFCGDLE
MRRNGVLIAFEEGTATFYALKNAEDRGAFFIEPGTKVYKGMIVGEHNRPQDLELNVCKTK
ALTNHRSATGDELVQLQTPIQMTLERALEYIGSDELLEVTPESIRLRKLLAKKLAKR