Protein Info for Synpcc7942_1474 in Synechococcus elongatus PCC 7942

Annotation: putative monovalent cation/H+ antiporter subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 28 to 47 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details PF00420: Oxidored_q2" amino acids 4 to 105 (102 residues), 74.9 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K05567, multicomponent Na+:H+ antiporter subunit C (inferred from 99% identity to syc:syc2460_c)

Predicted SEED Role

"Putative multicomponent Na+:H+ antiporter subunit C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31N65 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Synpcc7942_1474 putative monovalent cation/H+ antiporter subunit C (Synechococcus elongatus PCC 7942)
VIEGLILATLLIGFFGTLFKKNLIMKVIAMDVMSTGVITYYVVVAAREGLFTPILITDQN
QAYADPVPQAVILTAIVIGFSVQALILVGIMKLSRNNPTLEISEVERSNTQ