Protein Info for Synpcc7942_1455 in Synechococcus elongatus PCC 7942

Name: fabH
Annotation: 3-oxoacyl-(acyl carrier protein) synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 313 to 329 (17 residues), see Phobius details TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 8 to 331 (324 residues), 361.8 bits, see alignment E=1.5e-112 PF00108: Thiolase_N" amino acids 41 to 150 (110 residues), 27.8 bits, see alignment E=3.2e-10 PF08545: ACP_syn_III" amino acids 111 to 188 (78 residues), 110.7 bits, see alignment E=5.2e-36 PF02797: Chal_sti_synt_C" amino acids 230 to 326 (97 residues), 28.4 bits, see alignment E=3e-10 PF08541: ACP_syn_III_C" amino acids 244 to 331 (88 residues), 120 bits, see alignment E=7.9e-39

Best Hits

Swiss-Prot: 100% identical to FABH_SYNE7: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to syc:syc0102_c)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31N84 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Synpcc7942_1455 3-oxoacyl-(acyl carrier protein) synthase III (Synechococcus elongatus PCC 7942)
LTRPGVGVAITGSGSAVPSTTLSNDQLSQLVETSDEWIRSRTGIGQRRVAQPQIESLSSL
AAAAGQSALEAAGLEATSVDLILLATSTPDDLFGSACQVQAALGATQAVAFDLTAACSGF
LFALVTGAQFIRSGAYRTVLVIGADVLSRWTDWSDRRTCVLFGDGAGAVVLQASEIDQLL
GFEMRSDGSLNGCLTLAYQADNQSLLSDIEIAQGTYQPVAMNGQEVYRFAVKRVPEILEK
TLFHAGIDRQEVDWLLLHQANQRILDAVADRLDISRDRVLSNLVNYGNTSSATIPLVLDE
AVKAGKIQSGDLIAASGFGAGLSWGAALFRWGTVV