Protein Info for Synpcc7942_1410 in Synechococcus elongatus PCC 7942

Name: leuA
Annotation: 2-isopropylmalate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 TIGR00973: 2-isopropylmalate synthase" amino acids 9 to 516 (508 residues), 779.3 bits, see alignment E=6.6e-239 PF00682: HMGL-like" amino acids 10 to 292 (283 residues), 321.5 bits, see alignment E=6.1e-100 PF22617: HCS_D2" amino acids 306 to 386 (81 residues), 98.4 bits, see alignment E=3.7e-32 PF08502: LeuA_dimer" amino acids 388 to 518 (131 residues), 135.5 bits, see alignment E=1.6e-43

Best Hits

Swiss-Prot: 82% identical to LEU1_CYAA5: 2-isopropylmalate synthase (leuA) from Cyanothece sp. (strain ATCC 51142)

KEGG orthology group: K01649, 2-isopropylmalate synthase [EC: 2.3.3.13] (inferred from 100% identity to syf:Synpcc7942_1410)

Predicted SEED Role

"2-isopropylmalate synthase (EC 2.3.3.13)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 2.3.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.13

Use Curated BLAST to search for 2.3.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NC9 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Synpcc7942_1410 2-isopropylmalate synthase (Synechococcus elongatus PCC 7942)
MASASSNDRILIFDTTLRDGEQSPGASLNLEEKLAIARQLARLNVDIIEAGFAFASPGDF
EAVQRIAAEVGTPDGPTICSLARATRQDIKAAAEALAPAAKGRIHTFIATSDIHLEYKLK
KTRAEVLAVIPEMVGYAASLVDDVEFSPEDAGRSDPEFLYECLEAAIAAGAKTINIPDTV
GYTTPSEFGALIGGIKQNVCNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGI
GERAGNAALEELVMALHVRRQYFNPFLGRAADSEAPLTQVNTREIYKTSRLVSNLTGMLV
QPNKAIVGANAFAHESGIHQDGVLKNKLTYEIVDAETIGLSTNRITLGKLSGRNAFRTRL
QELGYDLGEDDLNRAFLRFKELADKKREVTDRDLEAIVNDETQQAPELFKLELVQVSAGD
HARPTATVTLRTPEGEELTDAAIGTGPVDAIYRAINRVVNIPNELIEFSVKSVTAGIDAI
GEVTIRLRHEDRIFSGHSANTDILVASAQAYIHALNRLAEALQKDKPLHPQEPIVAGMGR