Protein Info for Synpcc7942_1403 in Synechococcus elongatus PCC 7942

Annotation: Hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 4 to 258 (255 residues), 339.2 bits, see alignment E=6.8e-106 PF00753: Lactamase_B" amino acids 21 to 176 (156 residues), 62.1 bits, see alignment E=7.4e-21 PF16123: HAGH_C" amino acids 177 to 258 (82 residues), 100.9 bits, see alignment E=4.4e-33

Best Hits

Swiss-Prot: 100% identical to GLO2_SYNE7: Hydroxyacylglutathione hydrolase (gloB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 100% identity to syf:Synpcc7942_1403)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31ND6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Synpcc7942_1403 Hydroxyacylglutathione hydrolase (Synechococcus elongatus PCC 7942)
MRIDCLPALQDNYIFLLVDVEQRQAAVVDPAEAEPVLAALQAEGLTLTAILNTHHHGDHV
GGNRRLLRQFPEAAVSASAVDRDRIPGQTVLLEAGDRLQICGQTAEVLFVPGHTRGHIAY
YFPEVAEGNPRGALFCGDTLFAGGCGRLFEGTPAQMLDSLQQLRSLPDDTAIYCAHEYTL
NNLRFALTVEPDNFDLQQRYQAVAIARQQGQATIPSRLDIEKATNPFLRWDQAALQAAVS
SQDPVQTLARLRSRKDQF