Protein Info for Synpcc7942_1387 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00268: TIGR00268 family protein" amino acids 5 to 261 (257 residues), 312.4 bits, see alignment E=1.2e-97 PF00733: Asn_synthase" amino acids 7 to 83 (77 residues), 35.6 bits, see alignment E=8.9e-13 PF02540: NAD_synthase" amino acids 15 to 81 (67 residues), 28.5 bits, see alignment E=8.3e-11

Best Hits

Swiss-Prot: 65% identical to Y1717_SYNY3: Uncharacterized protein slr1717 (slr1717) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K06864, (no description) (inferred from 100% identity to syf:Synpcc7942_1387)

MetaCyc: 42% identical to pyridinium-3,5-biscarboxylic acid mononucleotide sulfurtransferase (Lactiplantibacillus plantarum)
RXN-19046 [EC: 4.4.1.37]; 4.4.1.37 [EC: 4.4.1.37]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 4.4.1.37 or 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NF2 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Synpcc7942_1387 hypothetical protein (Synechococcus elongatus PCC 7942)
MLQAKLEQVRSQLRSFPSALVAYSGGIDSSLVAYLAAQELGDRAIAVTAVSASLLPEDLE
AARSQAEWMGIAHEQIQTDELANPNYASNPSNRCYFCKSELHDRLQPLAQSRGFAVVLDG
VNADDLGDHRPGLQAAAERGVRSPLAEAGISKLEVRQLARELGMPWWDKPAMPCLSSRFP
YGEAITAEKLARVGAAERYLRQLGWQSIRVRSQQDTARIELPSTDLQRFVAETDLPVLVS
HFQSLGFRYVSLDLEGLVSGKLNRALTAACAGDRS