Protein Info for Synpcc7942_1346 in Synechococcus elongatus PCC 7942

Name: ndhE
Annotation: NADH dehydrogenase subunit K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 8 to 103 (96 residues), 111 bits, E=9.7e-37

Best Hits

Swiss-Prot: 91% identical to NU4LC_NOSS1: NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K05576, NADH dehydrogenase I subunit 4L [EC: 1.6.5.3] (inferred from 100% identity to syf:Synpcc7942_1346)

MetaCyc: 100% identical to ferredoxin-plastoquinone oxidoreductase subunit E (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See Q31NJ3 at UniProt or InterPro

Protein Sequence (103 amino acids)

>Synpcc7942_1346 NADH dehydrogenase subunit K (Synechococcus elongatus PCC 7942)
MTVPLEYFLVLAAALFCIGVYGLVTSRNAVRVLMSIELMLNAVNLNLMAFSNYLDGTLIR
GQVFTVFVITVAAAEAAVGLAILLAIYRNRNTVDMEQFNLLKW