Protein Info for Synpcc7942_1314 in Synechococcus elongatus PCC 7942

Name: ftsH
Annotation: FtsH-2 peptidase. Metallo peptidase. MEROPS family M41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 623 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details PF06480: FtsH_ext" amino acids 18 to 109 (92 residues), 38.7 bits, see alignment E=2.5e-13 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 117 to 612 (496 residues), 717 bits, see alignment E=6.3e-220 PF07728: AAA_5" amino acids 204 to 327 (124 residues), 25.3 bits, see alignment E=3.4e-09 PF00004: AAA" amino acids 205 to 339 (135 residues), 160 bits, see alignment E=1.1e-50 PF17862: AAA_lid_3" amino acids 362 to 405 (44 residues), 48.1 bits, see alignment 1.7e-16 PF01434: Peptidase_M41" amino acids 420 to 611 (192 residues), 234.1 bits, see alignment E=3e-73

Best Hits

Swiss-Prot: 73% identical to FTSH4_SYNY3: ATP-dependent zinc metalloprotease FtsH 4 (ftsH4) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to syc:syc0239_d)

MetaCyc: 50% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NM5 at UniProt or InterPro

Protein Sequence (623 amino acids)

>Synpcc7942_1314 FtsH-2 peptidase. Metallo peptidase. MEROPS family M41 (Synechococcus elongatus PCC 7942)
MAIKENPTRPSRNRIISFVLFGVGLFFLLIGLIPGVGSPQVSRVPYSLFIDQVNDGLVAR
AYITQEQIRYQLKDVEGEAGDVLSTTPIFDLELPQRLEQKGVEFAAAPPQKGNFFTTLLG
WIIPPLIFIGVLQFFAARQARNGPQGALSFTKSRAKVYVEGDDTRTTFSDVAGVEEAKAE
LQEIVDFLKTPERYLNIGARIPKGVLLVGPPGTGKTLLAKAVAGEARVPFFSISGSEFVE
LFVGAGAARVRDLFEQAKQKAPCIVFIDELDAIGKSRASGNFMGGNDEREQTLNQLLTEM
DGFSADGATVIVLAATNRPETLDPALLRPGRFDRQVLVDRPDLAGRKAILDIYGRKVKLD
PEVDLQAIAVRTSGFAGADLANLINEAALLAARNGRTEVAQADLNEAIERVVAGLEKKSR
VLNDNEKRIVAYHEVGHAIVGALMPGGSKVAKISIVPRGMAALGYTLQLPTEDRFLLSAE
ELKGQIATLLGGRSAEEIIFGSITTGASNDLQRATDVAEQMVTTYGMSQVLGPLAFDKGG
GNNFLGGEGMNPRRRVSDETAKAIDAEVKQLVDDGHDQALAILNRNRDLLEEIAQRILDV
EVIEGDELQSLLQRAELPELQPA