Protein Info for Synpcc7942_1294 in Synechococcus elongatus PCC 7942

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 PF00069: Pkinase" amino acids 34 to 284 (251 residues), 126.1 bits, see alignment E=6.9e-40 PF07714: PK_Tyr_Ser-Thr" amino acids 36 to 244 (209 residues), 54.3 bits, see alignment E=5.3e-18 PF03109: ABC1" amino acids 113 to 188 (76 residues), 23.3 bits, see alignment E=1.3e-08 PF14531: Kinase-like" amino acids 125 to 283 (159 residues), 26 bits, see alignment E=2.1e-09 PF13599: Pentapeptide_4" amino acids 396 to 457 (62 residues), 32 bits, see alignment E=5e-11 amino acids 431 to 504 (74 residues), 37.3 bits, see alignment E=1.1e-12 PF00805: Pentapeptide" amino acids 427 to 463 (37 residues), 35.3 bits, see alignment 2.8e-12 amino acids 465 to 498 (34 residues), 40.3 bits, see alignment (E = 7.1e-14)

Best Hits

KEGG orthology group: K08884, serine/threonine protein kinase, bacterial [EC: 2.7.11.1] (inferred from 100% identity to syc:syc0259_c)

Predicted SEED Role

"Serine/threonine-protein kinase B (EC 2.7.11.1)" (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31NP5 at UniProt or InterPro

Protein Sequence (522 amino acids)

>Synpcc7942_1294 serine/threonine protein kinase (Synechococcus elongatus PCC 7942)
MALCLNPDCGQPNNDDANSSCATCGSPLLLRDRYRVVKAIGQGGFGATYLGQDLQLPGEP
LCVIKQLLPQVQDPEIMLMARELFRREAKTLGRIGSHPQVPTLLDYFEAPEGFYLVQEYI
RGKTLEQEVREQGVYSETATKQFLSELLPLLQYLHNQGVIHRDIKPANLLRRDIDRRLVL
IDFGAVKDQVSQIQGGSGLTALTSFSVGTRGYAPPEQLAMRPVYSSDLYSLGVTCLFLMT
GKGPQDLDYNPVTGELLWRNSVQVSDALATVLGKMLAASVRYRYQRAEQVMTALDLQPYH
DSLIQGLSALPPGAPPIKPSSGRTGSGYPSPQERQAEAIRARRRDRSGNRPEQLADAQQI
AAWTGGTSNTSGNNSAGRLSLNARDILATYQRGRRDFSQQPLNRIDLSESQLPSVNFQGA
QLKESLFVAAQLERADFGQANLHRANLRRANLHQAYFGNADLSFANLQKADLSDAILSNA
NLRGTNLCGANLRGAKLTPVQLKMAKTNWWTILPDGRRGRLF