Protein Info for Synpcc7942_1286 in Synechococcus elongatus PCC 7942

Name: moeA
Annotation: molybdopterin molybdochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF03453: MoeA_N" amino acids 4 to 170 (167 residues), 143.1 bits, see alignment E=9.2e-46 PF00994: MoCF_biosynth" amino acids 184 to 324 (141 residues), 99.2 bits, see alignment E=2.6e-32 PF03454: MoeA_C" amino acids 337 to 401 (65 residues), 31.4 bits, see alignment E=2.7e-11

Best Hits

Swiss-Prot: 100% identical to MOEA_SYNE7: Molybdopterin molybdenumtransferase (moeA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to syf:Synpcc7942_1286)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q56207 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Synpcc7942_1286 molybdopterin molybdochelatase (Synechococcus elongatus PCC 7942)
MILSYSAAIELLLAEVAQLPLAIERVPLLETGDRLLAKDLAAPCDLPHWDNSAMDGFALR
SQDVAAASPDRPVRLPVVGRVMAGEQPPLLANPTGVACAVMTGAPIPAGFDVIVKVEDVV
QEENAIAVSTPIPAGQFIRRQGEDLRQGSPLLAKGQRLTPMALMLAAAVGMGELPVWSKL
PVGLISTGTEVVPWSQPTLELGQIRNSSQPFLIEQLQRLGCEVRAIAHVPDDPEQFAAIA
QQFWSQGVRLLLTTGAVSMGVADFVPAALERLGCQTIFHKVAIRPGKPLLFAIAPEHQGL
VLACPGNPVSTTVTAEFFLKPLLMACRNEVRSPLWLPLAESVRKPEGLQCFWRSRLTPEG
KVWVDPQQSSAALKSLVESTHWAILPAGQDFLAAGTPVEVRSL